Glucagon 16941-32-5

Glucagon 16941-32-5

Contact : Mr.Thyen------------------------------- Email us at zhangyinglong@ycphar.com Whatsapp : +86 180 3817 6818

Product Details


Glucagon 6941-32-5

Contact : Mr.Thyen

Email us at zhangyinglong@ycphar.com

Whatsapp : +86 180 3817 6818



Product Name:Glucagon
Synonyms:GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;OXYNTOMODULIN (PORCINE);OXYNTOMODULIN
CAS:16941-32-5
MF:C153H225N43O49S
MW:3482.75
EINECS:232-708-2
Product Categories:Amino Acid Derivatives;Peptide;GlucagonIslet Stem Cell Biology;Islet Stem Cell Differentiation;Hormones;Other Protein/Peptide Hormones;Glucagon and Glucagon-Like PeptidesPeptides for Cell Biology;GlucagonsIslet Stem Cell Biology;Cytokines Growth Factors and Hormones (Obesity);Gastrointestinal Peptides;GlucagonObesity Research;API;Diabetes Research
Purity:98%.99%


 
What is Glucagon Acetate ?
 
Glucagon is a peptide hormone, produced by alpha cells of the pancreas, that raises the concentration of glucose in the bloodstream. Its effect is opposite that of , which lowers the glucose concentration.The pancreas releases glucagon when the concentration of glucose in the bloodstream falls too low. Glucagon causes the liver to convert stored glycogen into glucose, which is released into the bloodstream. High blood glucose levels stimulate the release of. allows glucose to be taken up and used by -dependent tissues. Thus, glucagon and insulin are part of a feedback system that keeps blood glucose levels at a stable level. Glucagon belongs to a family of several other related hormones.
 

Our Competitive Advantages 

  1. Rich experience.
    Our company is a professional production leading factory in China in pharmaceutical area of many years

  2. Superior quality, purity and favourable.
    Our company is a professional leading manufacturer in China in pharmaceutical area.Good quality is one of our secret success.

  3. Safe and fast delivery.
    We have GOLDEN FORWARDER and Hongkong Warehouse  so we can delivery quickly and safely.

  4. Package: Professional packing with professional materials.

  5. Competitive Prices : Low price with high qulity.


Peptides Product list


  1. Melanotan 2(10mg)

  2. Melanotan 1(10mg)

  3. GHRP-6(10mg)

  4. GHRP-6(5mg)   

  5. GHRP-2(10mg) 

  6. GHRP-2(5mg)

  7. CJC 1295(2mg)         

  8. CJC 1295 DAC(2mg)      

  9. Ipamorelin(2mg)

  10. Ipamorelin(5mg)       

  11. MGF(2mg)               

  12. MGF(5mg)

  13. PEG-MGF(2mg)          

  14. AOD 9604(2mg)          

  15. BPC 157(2mg)

  16. BPC 157(5mg)          

  17. TB-500(2mg)           

  18. TB-500(5mg)

  19. PT-141(10mg)          

  20. Hexarelin(2mg)         

  21. Sermorelin(2mg)

  22. ACE-031(1mg)          

  23. Follistatin 344(1mg)   

  24. Follistatin 315(1mg)   

  25. GDF-8(1mg)

  26. Oxytocin(2mg)         

  27. Triptorelin(2mg)       

  28. HGH fragment (2mg)

  29. HGH fragment (5mg)

  30. HGH fragment (10mg)

  31. Tesamorelin(2mg)

  32. IGF-1lr3(0.1mg)

  33. IGF-1lr3(1mg)     

  34. Gonadorelin(2mg)

  35. Gonadorelin(10mg)     

  36. DSIP(2mg)              

  37. Selank(5mg)

  38. Epitalon(10mg)    

  39. Deslorelin(20mg)       

  40. Thymosin α1 Acetate(10mg)

1_副本

Hot Tags: Glucagon 16941-32-5, China, suppliers, manufacturers, wholesale, buy, price

Inquiry

You Might Also Like